Sites hosted in Waltham, Massachusetts, United States (68,387 found)

There are a total of 68,387 active domains currently hosted at a data center in the City: Waltham, Massachusetts, United States [Region ID: 7295]

Domain Name ISP and Geolocation [ Country / State / City ] Alexa Rank Status
1 pornhub.compornhub.com
IP Address: 66.254.114.41
quadspeedi.netQuad Speed Internet
United States / Massachusetts / Waltham
58 Active
2 youporn.comyouporn.com
IP Address: 66.254.114.79
quadspeedi.netQuad Speed Internet
United States / Massachusetts / Waltham
423 Active
3 pornhubpremium.compornhubpremium.com
IP Address: 66.254.114.44
quadspeedi.netQuad Speed Internet
United States / Massachusetts / Waltham
568 Active
4 redtube.comredtube.com
IP Address: 216.18.168.124
reflected.netReflected Networks Inc.
United States / Massachusetts / Waltham
614 Active
5 constantcontact.comconstantcontact.com
IP Address: 208.75.122.14
constantcontact.comConstant Contact Inc
United States / Massachusetts / Waltham
699 Active
6 youjizz.comyoujizz.com
IP Address: 216.18.168.162
reflected.netReflected Networks Inc.
United States / Massachusetts / Waltham
1,527 Active
7 tube8.comtube8.com
IP Address: 216.18.168.66
reflected.netReflected Networks Inc.
United States / Massachusetts / Waltham
1,624 Active
8 xtube.comxtube.com
IP Address: 66.254.114.138
quadspeedi.netQuad Speed Internet
United States / Massachusetts / Waltham
2,564 Active
9 brazzers.combrazzers.com
IP Address: 216.18.168.70
reflected.netReflected Networks Inc.
United States / Massachusetts / Waltham
2,596 Active
10 nutaku.netnutaku.net
IP Address: 64.210.149.51
reflected.netReflected Networks Inc.
United States / Massachusetts / Waltham
2,705 Active
11 spankwire.comspankwire.com
IP Address: 66.254.114.180
quadspeedi.netQuad Speed Internet
United States / Massachusetts / Waltham
2,747 Active
12 generalunion.orggeneralunion.org
IP Address: 192.252.146.40
suresupport.comSureSupport LLC
United States / Massachusetts / Waltham
3,006 Active
13 uptodate.comuptodate.com
IP Address: 199.107.238.205
uptodate.comUptodate - NYC
United States / Massachusetts / Waltham
3,837 Active
14 brazzersnetwork.combrazzersnetwork.com
IP Address: 66.254.114.54
quadspeedi.netQuad Speed Internet
United States / Massachusetts / Waltham
4,304 Active
15 thumbzilla.comthumbzilla.com
IP Address: 66.254.114.42
quadspeedi.netQuad Speed Internet
United States / Massachusetts / Waltham
4,336 Active
16 hentaiplaytime.comhentaiplaytime.com
IP Address: 216.18.168.122
reflected.netReflected Networks Inc.
United States / Massachusetts / Waltham
4,403 Active
17 pornhub.orgpornhub.org
IP Address: 66.254.114.41
quadspeedi.netQuad Speed Internet
United States / Massachusetts / Waltham
4,837 Active
18 extremetube.comextremetube.com
IP Address: 66.254.114.184
quadspeedi.netQuad Speed Internet
United States / Massachusetts / Waltham
6,083 Active
19 probiller.comprobiller.com
IP Address: 208.99.66.28
reflected.netReflected Networks Inc.
United States / Massachusetts / Waltham
6,500 Active
20 keezmovies.comkeezmovies.com
IP Address: 66.254.114.182
quadspeedi.netQuad Speed Internet
United States / Massachusetts / Waltham
6,852 Active
21 pornhubsurvey.compornhubsurvey.com
IP Address: 216.18.168.122
reflected.netReflected Networks Inc.
United States / Massachusetts / Waltham
7,071 Active
22 redtube.com.brredtube.com.br
IP Address: 216.18.168.124
reflected.netReflected Networks Inc.
United States / Massachusetts / Waltham
7,128 Active
23 pornmd.compornmd.com
IP Address: 66.254.114.36
quadspeedi.netQuad Speed Internet
United States / Massachusetts / Waltham
7,340 Active
24 camsoda.comcamsoda.com
IP Address: 208.99.67.227
reflected.netReflected Networks Inc.
United States / Massachusetts / Waltham
10,308 Active
25 mydirtyhobby.commydirtyhobby.com
IP Address: 64.210.159.102
reflected.netReflected Networks Inc.
United States / Massachusetts / Waltham
11,566 Active
26 bluesnap.combluesnap.com
IP Address: 141.226.140.63
bluesnap.comBlueSnap Inc
United States / Massachusetts / Waltham
11,930 Active
27 lionbridge.comlionbridge.com
IP Address: 65.213.75.121
lionbridge.comLionbridge Technologies Inc
United States / Massachusetts / Waltham
12,425 Active
28 fling.comfling.com
IP Address: 64.210.151.36
reflected.netReflected Networks Inc.
United States / Massachusetts / Waltham
13,118 Active
29 realitykings.comrealitykings.com
IP Address: 66.254.114.54
quadspeedi.netQuad Speed Internet
United States / Massachusetts / Waltham
13,606 Active
30 watchmygirlfriend.tvwatchmygirlfriend.tv
IP Address: 66.254.103.140
reflected.netReflected Networks Inc.
United States / Massachusetts / Waltham
13,954 Active
31 adultforce.comadultforce.com
IP Address: 66.254.114.168
quadspeedi.netQuad Speed Internet
United States / Massachusetts / Waltham
14,092 Active
32 mydirtyhobby.demydirtyhobby.de
IP Address: 66.254.114.125
quadspeedi.netQuad Speed Internet
United States / Massachusetts / Waltham
14,192 Active
33 trafficjunky.comtrafficjunky.com
IP Address: 66.254.114.181
quadspeedi.netQuad Speed Internet
United States / Massachusetts / Waltham
15,185 Active
34 youporngay.comyouporngay.com
IP Address: 66.254.114.79
quadspeedi.netQuad Speed Internet
United States / Massachusetts / Waltham
15,193 Active
35 pornxs.compornxs.com
IP Address: 66.254.114.120
quadspeedi.netQuad Speed Internet
United States / Massachusetts / Waltham
15,231 Active
36 modelhub.commodelhub.com
IP Address: 66.254.114.41
quadspeedi.netQuad Speed Internet
United States / Massachusetts / Waltham
15,416 Active
37 trannytube.tvtrannytube.tv
IP Address: 66.254.114.1
quadspeedi.netQuad Speed Internet
United States / Massachusetts / Waltham
16,043 Active
38 xdating.comxdating.com
IP Address: 64.210.151.36
reflected.netReflected Networks Inc.
United States / Massachusetts / Waltham
16,102 Active
39 sportsmans.comsportsmans.com
IP Address: 157.133.232.138
sybase.comSybase Inc.
United States / Massachusetts / Waltham
16,627 Active
40 trafficjunky.nettrafficjunky.net
IP Address: 66.254.100.208
reflected.netReflected Networks Inc.
United States / Massachusetts / Waltham
18,355 Active
41 chatstar.comchatstar.com
IP Address: 208.99.67.227
reflected.netReflected Networks Inc.
United States / Massachusetts / Waltham
26,127 Active
42 boy18tube.comboy18tube.com
IP Address: 216.18.168.155
reflected.netReflected Networks Inc.
United States / Massachusetts / Waltham
27,220 Active
43 mofos.commofos.com
IP Address: 66.254.114.54
quadspeedi.netQuad Speed Internet
United States / Massachusetts / Waltham
27,438 Active
44 rk.comrk.com
IP Address: 66.254.114.54
quadspeedi.netQuad Speed Internet
United States / Massachusetts / Waltham
30,366 Active
45 lpsg.comlpsg.com
IP Address: 66.254.114.59
quadspeedi.netQuad Speed Internet
United States / Massachusetts / Waltham
31,057 Active
46 julesjordan.comjulesjordan.com
IP Address: 216.18.176.58
reflected.netReflected Networks Inc.
United States / Massachusetts / Waltham
31,426 Active
47 pornhubapparel.compornhubapparel.com
IP Address: 216.18.168.79
reflected.netReflected Networks Inc.
United States / Massachusetts / Waltham
32,227 Active
48 sureserver.comsureserver.com
IP Address: 192.252.159.138
suresupport.comSureSupport LLC
United States / Massachusetts / Waltham
33,745 Active
49 you-porn.comyou-porn.com
IP Address: 66.254.114.79
quadspeedi.netQuad Speed Internet
United States / Massachusetts / Waltham
33,919 Active
50 gayporno.fmgayporno.fm
IP Address: 216.18.168.156
reflected.netReflected Networks Inc.
United States / Massachusetts / Waltham
34,405 Active
51 lilhumpers.comlilhumpers.com
IP Address: 66.254.114.54
quadspeedi.netQuad Speed Internet
United States / Massachusetts / Waltham
35,150 Active
52 fakehub.comfakehub.com
IP Address: 66.254.114.54
quadspeedi.netQuad Speed Internet
United States / Massachusetts / Waltham
35,151 Active
53 pornhubselect.compornhubselect.com
IP Address: 66.254.114.42
quadspeedi.netQuad Speed Internet
United States / Massachusetts / Waltham
35,721 Active
54 ice-gay.comice-gay.com
IP Address: 66.254.114.68
quadspeedi.netQuad Speed Internet
United States / Massachusetts / Waltham
36,216 Active
55 dogfartnetwork.comdogfartnetwork.com
IP Address: 66.254.99.240
reflected.netReflected Networks Inc.
United States / Massachusetts / Waltham
38,429 Active
56 dianibeachalets.comdianibeachalets.com
IP Address: 192.252.151.42
suresupport.comSureSupport LLC
United States / Massachusetts / Waltham
38,601 Active
57 ticketnetwork.comticketnetwork.com
IP Address: 157.133.232.33
sybase.comSybase Inc.
United States / Massachusetts / Waltham
40,142 Active
58 lesbianpornvideos.comlesbianpornvideos.com
IP Address: 66.254.121.98
reflected.netReflected Networks Inc.
United States / Massachusetts / Waltham
41,052 Active
59 tube8.frtube8.fr
IP Address: 216.18.168.66
reflected.netReflected Networks Inc.
United States / Massachusetts / Waltham
41,410 Active
60 icegay.tvicegay.tv
IP Address: 216.18.168.158
reflected.netReflected Networks Inc.
United States / Massachusetts / Waltham
41,489 Active
61 youpornpremium.comyoupornpremium.com
IP Address: 66.254.114.78
quadspeedi.netQuad Speed Internet
United States / Massachusetts / Waltham
42,236 Active
62 nutaku.comnutaku.com
IP Address: 64.210.149.50
reflected.netReflected Networks Inc.
United States / Massachusetts / Waltham
43,617 Active
63 redtube.netredtube.net
IP Address: 216.18.168.124
reflected.netReflected Networks Inc.
United States / Massachusetts / Waltham
45,504 Active
64 mofosex.commofosex.com
IP Address: 66.254.114.219
quadspeedi.netQuad Speed Internet
United States / Massachusetts / Waltham
47,129 Active
65 afcpatrk.comafcpatrk.com
IP Address: 216.18.168.122
reflected.netReflected Networks Inc.
United States / Massachusetts / Waltham
47,963 Active
66 cartoonpornvideos.comcartoonpornvideos.com
IP Address: 208.99.83.18
reflected.netReflected Networks Inc.
United States / Massachusetts / Waltham
48,897 Active
67 digitalplayground.comdigitalplayground.com
IP Address: 66.254.114.54
quadspeedi.netQuad Speed Internet
United States / Massachusetts / Waltham
51,369 Active
68 tube8.estube8.es
IP Address: 216.18.168.66
reflected.netReflected Networks Inc.
United States / Massachusetts / Waltham
52,387 Active
69 paperstreetcash.compaperstreetcash.com
IP Address: 66.254.109.5
reflected.netReflected Networks Inc.
United States / Massachusetts / Waltham
53,759 Active
70 femjoy.comfemjoy.com
IP Address: 216.18.185.244
reflected.netReflected Networks Inc.
United States / Massachusetts / Waltham
53,900 Active
71 men.commen.com
IP Address: 66.254.114.54
quadspeedi.netQuad Speed Internet
United States / Massachusetts / Waltham
55,201 Active
72 brazzerssurvey.combrazzerssurvey.com
IP Address: 216.18.168.122
reflected.netReflected Networks Inc.
United States / Massachusetts / Waltham
56,471 Active
73 playboyplus.complayboyplus.com
IP Address: 66.254.119.42
reflected.netReflected Networks Inc.
United States / Massachusetts / Waltham
56,511 Active
74 advertiserurl.comadvertiserurl.com
IP Address: 64.210.142.4
reflected.netReflected Networks Inc.
United States / Massachusetts / Waltham
57,733 Active
75 julesjordanvideo.comjulesjordanvideo.com
IP Address: 216.18.172.194
reflected.netReflected Networks Inc.
United States / Massachusetts / Waltham
62,448 Active
76 contentabc.comcontentabc.com
IP Address: 64.88.250.214
reflected.netSwiftwill Inc.
United States / Massachusetts / Waltham
63,104 Active
77 mennetwork.commennetwork.com
IP Address: 66.254.114.54
quadspeedi.netQuad Speed Internet
United States / Massachusetts / Waltham
63,452 Active
78 melicplay.commelicplay.com
IP Address: 66.254.111.66
reflected.netReflected Networks Inc.
United States / Massachusetts / Waltham
64,819 Active
79 babes.combabes.com
IP Address: 66.254.114.54
quadspeedi.netQuad Speed Internet
United States / Massachusetts / Waltham
65,173 Active
80 etnamedia.netetnamedia.net
IP Address: 66.254.100.9
reflected.netReflected Networks Inc.
United States / Massachusetts / Waltham
65,197 Active
81 good-gay.tvgood-gay.tv
IP Address: 216.18.168.143
reflected.netReflected Networks Inc.
United States / Massachusetts / Waltham
65,432 Active
82 kingtwinks.comkingtwinks.com
IP Address: 216.18.168.120
reflected.netReflected Networks Inc.
United States / Massachusetts / Waltham
66,541 Active
83 youngpornvideos.comyoungpornvideos.com
IP Address: 208.99.76.166
reflected.netReflected Networks Inc.
United States / Massachusetts / Waltham
67,092 Active
84 worldsex.comworldsex.com
IP Address: 66.254.98.132
reflected.netReflected Networks Inc.
United States / Massachusetts / Waltham
67,740 Active
85 youtrannytube.comyoutrannytube.com
IP Address: 66.254.114.21
quadspeedi.netQuad Speed Internet
United States / Massachusetts / Waltham
68,126 Active
86 erocurves.comerocurves.com
IP Address: 216.18.172.106
reflected.netReflected Networks Inc.
United States / Massachusetts / Waltham
68,357 Active
87 blacksonblondes.comblacksonblondes.com
IP Address: 66.254.99.240
reflected.netReflected Networks Inc.
United States / Massachusetts / Waltham
68,371 Active
88 xl-gaytube.comxl-gaytube.com
IP Address: 66.254.114.70
quadspeedi.netQuad Speed Internet
United States / Massachusetts / Waltham
69,637 Active
89 redtubepremium.comredtubepremium.com
IP Address: 66.254.114.78
quadspeedi.netQuad Speed Internet
United States / Massachusetts / Waltham
70,026 Active
90 rong-chang.comrong-chang.com
IP Address: 192.252.146.14
suresupport.comSureSupport LLC
United States / Massachusetts / Waltham
70,570 Active
91 martinsatacado.com.brmartinsatacado.com.br
IP Address: 157.133.232.57
sybase.comSybase Inc.
United States / Massachusetts / Waltham
70,921 Active
92 hugetraffic.comhugetraffic.com
IP Address: 64.210.151.40
reflected.netReflected Networks Inc.
United States / Massachusetts / Waltham
70,952 Active
93 good-gay.comgood-gay.com
IP Address: 66.254.114.71
quadspeedi.netQuad Speed Internet
United States / Massachusetts / Waltham
73,546 Active
94 gaytube.comgaytube.com
IP Address: 66.254.114.158
quadspeedi.netQuad Speed Internet
United States / Massachusetts / Waltham
79,567 Active
95 gfpornmovies.comgfpornmovies.com
IP Address: 66.254.103.145
reflected.netReflected Networks Inc.
United States / Massachusetts / Waltham
79,926 Active
96 gayfuckporn.comgayfuckporn.com
IP Address: 66.254.114.67
quadspeedi.netQuad Speed Internet
United States / Massachusetts / Waltham
80,321 Active
97 sexyhub.comsexyhub.com
IP Address: 66.254.114.54
quadspeedi.netQuad Speed Internet
United States / Massachusetts / Waltham
81,010 Active
98 newsensations.comnewsensations.com
IP Address: 66.254.114.75
quadspeedi.netQuad Speed Internet
United States / Massachusetts / Waltham
81,498 Active
99 liltmedia.comliltmedia.com
IP Address: 66.254.111.91
reflected.netReflected Networks Inc.
United States / Massachusetts / Waltham
81,540 Active
100 buddyplay.netbuddyplay.net
IP Address: 66.254.111.108
reflected.netReflected Networks Inc.
United States / Massachusetts / Waltham
83,072 Active
Fetch Results through API Results Cost
https://api.dnsmap.com/?key={YOUR_API_KEY}&country=US&state=Massachusetts&city=Waltham
100 1 credit
{
    "api": {
        "success": true,
        "query_type": "city",
        "country_code": "US",
        "state_name": "Massachusetts",
        "city_name": "Waltham",
        "page_num": 1
    },
    "results": {
        "1": {
            "host_name": "pornhub.com",
            "ip_address": "66.254.114.41",
            "cur_status": "active",
            "alexa_rank": 58,
            "isp_id": 714829,
            "isp_name": "Quad Speed Internet",
            "isp_domain": "quadspeedi.net",
            "city_name": "Waltham",
            "state_name": "Massachusetts",
            "country_name": "United States",
            "country_code": "US"
        },
        "2": {
            "host_name": "youporn.com",
            "ip_address": "66.254.114.79",
            "cur_status": "active",
            "alexa_rank": 423,
            "isp_id": 714829,
            "isp_name": "Quad Speed Internet",
            "isp_domain": "quadspeedi.net",
            "city_name": "Waltham",
            "state_name": "Massachusetts",
            "country_name": "United States",
            "country_code": "US"
        },
        "3": {
            "host_name": "pornhubpremium.com",
            "ip_address": "66.254.114.44",
            "cur_status": "active",
            "alexa_rank": 568,
            "isp_id": 714829,
            "isp_name": "Quad Speed Internet",
            "isp_domain": "quadspeedi.net",
            "city_name": "Waltham",
            "state_name": "Massachusetts",
            "country_name": "United States",
            "country_code": "US"
        },
        "4": {
            "host_name": "redtube.com",
            "ip_address": "216.18.168.124",
            "cur_status": "active",
            "alexa_rank": 614,
            "isp_id": 714828,
            "isp_name": "Reflected Networks Inc.",
            "isp_domain": "reflected.net",
            "city_name": "Waltham",
            "state_name": "Massachusetts",
            "country_name": "United States",
            "country_code": "US"
        },
        "5": {
            "host_name": "constantcontact.com",
            "ip_address": "208.75.122.14",
            "cur_status": "active",
            "alexa_rank": 699,
            "isp_id": 663070,
            "isp_name": "Constant Contact Inc",
            "isp_domain": "constantcontact.com",
            "city_name": "Waltham",
            "state_name": "Massachusetts",
            "country_name": "United States",
            "country_code": "US"
        },
        "6": {
            "host_name": "youjizz.com",
            "ip_address": "216.18.168.162",
            "cur_status": "active",
            "alexa_rank": 1527,
            "isp_id": 714828,
            "isp_name": "Reflected Networks Inc.",
            "isp_domain": "reflected.net",
            "city_name": "Waltham",
            "state_name": "Massachusetts",
            "country_name": "United States",
            "country_code": "US"
        },
        "7": {
            "host_name": "tube8.com",
            "ip_address": "216.18.168.66",
            "cur_status": "active",
            "alexa_rank": 1624,
            "isp_id": 714828,
            "isp_name": "Reflected Networks Inc.",
            "isp_domain": "reflected.net",
            "city_name": "Waltham",
            "state_name": "Massachusetts",
            "country_name": "United States",
            "country_code": "US"
        },
        "8": {
            "host_name": "xtube.com",
            "ip_address": "66.254.114.138",
            "cur_status": "active",
            "alexa_rank": 2564,
            "isp_id": 714829,
            "isp_name": "Quad Speed Internet",
            "isp_domain": "quadspeedi.net",
            "city_name": "Waltham",
            "state_name": "Massachusetts",
            "country_name": "United States",
            "country_code": "US"
        },
        "9": {
            "host_name": "brazzers.com",
            "ip_address": "216.18.168.70",
            "cur_status": "active",
            "alexa_rank": 2596,
            "isp_id": 714828,
            "isp_name": "Reflected Networks Inc.",
            "isp_domain": "reflected.net",
            "city_name": "Waltham",
            "state_name": "Massachusetts",
            "country_name": "United States",
            "country_code": "US"
        },
        "10": {
            "host_name": "nutaku.net",
            "ip_address": "64.210.149.51",
            "cur_status": "active",
            "alexa_rank": 2705,
            "isp_id": 714828,
            "isp_name": "Reflected Networks Inc.",
            "isp_domain": "reflected.net",
            "city_name": "Waltham",
            "state_name": "Massachusetts",
            "country_name": "United States",
            "country_code": "US"
        },
        "11": {
            "host_name": "spankwire.com",
            "ip_address": "66.254.114.180",
            "cur_status": "active",
            "alexa_rank": 2747,
            "isp_id": 714829,
            "isp_name": "Quad Speed Internet",
            "isp_domain": "quadspeedi.net",
            "city_name": "Waltham",
            "state_name": "Massachusetts",
            "country_name": "United States",
            "country_code": "US"
        },
        "12": {
            "host_name": "generalunion.org",
            "ip_address": "192.252.146.40",
            "cur_status": "active",
            "alexa_rank": 3006,
            "isp_id": 620872,
            "isp_name": "SureSupport LLC",
            "isp_domain": "suresupport.com",
            "city_name": "Waltham",
            "state_name": "Massachusetts",
            "country_name": "United States",
            "country_code": "US"
        },
        "13": {
            "host_name": "uptodate.com",
            "ip_address": "199.107.238.205",
            "cur_status": "active",
            "alexa_rank": 3837,
            "isp_id": 610233,
            "isp_name": "Uptodate - NYC",
            "isp_domain": "uptodate.com",
            "city_name": "Waltham",
            "state_name": "Massachusetts",
            "country_name": "United States",
            "country_code": "US"
        },
        "14": {
            "host_name": "brazzersnetwork.com",
            "ip_address": "66.254.114.54",
            "cur_status": "active",
            "alexa_rank": 4304,
            "isp_id": 714829,
            "isp_name": "Quad Speed Internet",
            "isp_domain": "quadspeedi.net",
            "city_name": "Waltham",
            "state_name": "Massachusetts",
            "country_name": "United States",
            "country_code": "US"
        },
        "15": {
            "host_name": "thumbzilla.com",
            "ip_address": "66.254.114.42",
            "cur_status": "active",
            "alexa_rank": 4336,
            "isp_id": 714829,
            "isp_name": "Quad Speed Internet",
            "isp_domain": "quadspeedi.net",
            "city_name": "Waltham",
            "state_name": "Massachusetts",
            "country_name": "United States",
            "country_code": "US"
        },
        "16": {
            "host_name": "hentaiplaytime.com",
            "ip_address": "216.18.168.122",
            "cur_status": "active",
            "alexa_rank": 4403,
            "isp_id": 714828,
            "isp_name": "Reflected Networks Inc.",
            "isp_domain": "reflected.net",
            "city_name": "Waltham",
            "state_name": "Massachusetts",
            "country_name": "United States",
            "country_code": "US"
        },
        "17": {
            "host_name": "pornhub.org",
            "ip_address": "66.254.114.41",
            "cur_status": "active",
            "alexa_rank": 4837,
            "isp_id": 714829,
            "isp_name": "Quad Speed Internet",
            "isp_domain": "quadspeedi.net",
            "city_name": "Waltham",
            "state_name": "Massachusetts",
            "country_name": "United States",
            "country_code": "US"
        },
        "18": {
            "host_name": "extremetube.com",
            "ip_address": "66.254.114.184",
            "cur_status": "active",
            "alexa_rank": 6083,
            "isp_id": 714829,
            "isp_name": "Quad Speed Internet",
            "isp_domain": "quadspeedi.net",
            "city_name": "Waltham",
            "state_name": "Massachusetts",
            "country_name": "United States",
            "country_code": "US"
        },
        "19": {
            "host_name": "probiller.com",
            "ip_address": "208.99.66.28",
            "cur_status": "active",
            "alexa_rank": 6500,
            "isp_id": 714828,
            "isp_name": "Reflected Networks Inc.",
            "isp_domain": "reflected.net",
            "city_name": "Waltham",
            "state_name": "Massachusetts",
            "country_name": "United States",
            "country_code": "US"
        },
        "20": {
            "host_name": "keezmovies.com",
            "ip_address": "66.254.114.182",
            "cur_status": "active",
            "alexa_rank": 6852,
            "isp_id": 714829,
            "isp_name": "Quad Speed Internet",
            "isp_domain": "quadspeedi.net",
            "city_name": "Waltham",
            "state_name": "Massachusetts",
            "country_name": "United States",
            "country_code": "US"
        },
        "21": {
            "host_name": "pornhubsurvey.com",
            "ip_address": "216.18.168.122",
            "cur_status": "active",
            "alexa_rank": 7071,
            "isp_id": 714828,
            "isp_name": "Reflected Networks Inc.",
            "isp_domain": "reflected.net",
            "city_name": "Waltham",
            "state_name": "Massachusetts",
            "country_name": "United States",
            "country_code": "US"
        },
        "22": {
            "host_name": "redtube.com.br",
            "ip_address": "216.18.168.124",
            "cur_status": "active",
            "alexa_rank": 7128,
            "isp_id": 714828,
            "isp_name": "Reflected Networks Inc.",
            "isp_domain": "reflected.net",
            "city_name": "Waltham",
            "state_name": "Massachusetts",
            "country_name": "United States",
            "country_code": "US"
        },
        "23": {
            "host_name": "pornmd.com",
            "ip_address": "66.254.114.36",
            "cur_status": "active",
            "alexa_rank": 7340,
            "isp_id": 714829,
            "isp_name": "Quad Speed Internet",
            "isp_domain": "quadspeedi.net",
            "city_name": "Waltham",
            "state_name": "Massachusetts",
            "country_name": "United States",
            "country_code": "US"
        },
        "24": {
            "host_name": "camsoda.com",
            "ip_address": "208.99.67.227",
            "cur_status": "active",
            "alexa_rank": 10308,
            "isp_id": 714828,
            "isp_name": "Reflected Networks Inc.",
            "isp_domain": "reflected.net",
            "city_name": "Waltham",
            "state_name": "Massachusetts",
            "country_name": "United States",
            "country_code": "US"
        },
        "25": {
            "host_name": "mydirtyhobby.com",
            "ip_address": "64.210.159.102",
            "cur_status": "active",
            "alexa_rank": 11566,
            "isp_id": 714828,
            "isp_name": "Reflected Networks Inc.",
            "isp_domain": "reflected.net",
            "city_name": "Waltham",
            "state_name": "Massachusetts",
            "country_name": "United States",
            "country_code": "US"
        },
        "26": {
            "host_name": "bluesnap.com",
            "ip_address": "141.226.140.63",
            "cur_status": "active",
            "alexa_rank": 11930,
            "isp_id": 1169998,
            "isp_name": "BlueSnap Inc",
            "isp_domain": "bluesnap.com",
            "city_name": "Waltham",
            "state_name": "Massachusetts",
            "country_name": "United States",
            "country_code": "US"
        },
        "27": {
            "host_name": "lionbridge.com",
            "ip_address": "65.213.75.121",
            "cur_status": "active",
            "alexa_rank": 12425,
            "isp_id": 307237,
            "isp_name": "Lionbridge Technologies Inc",
            "isp_domain": "lionbridge.com",
            "city_name": "Waltham",
            "state_name": "Massachusetts",
            "country_name": "United States",
            "country_code": "US"
        },
        "28": {
            "host_name": "fling.com",
            "ip_address": "64.210.151.36",
            "cur_status": "active",
            "alexa_rank": 13118,
            "isp_id": 714828,
            "isp_name": "Reflected Networks Inc.",
            "isp_domain": "reflected.net",
            "city_name": "Waltham",
            "state_name": "Massachusetts",
            "country_name": "United States",
            "country_code": "US"
        },
        "29": {
            "host_name": "realitykings.com",
            "ip_address": "66.254.114.54",
            "cur_status": "active",
            "alexa_rank": 13606,
            "isp_id": 714829,
            "isp_name": "Quad Speed Internet",
            "isp_domain": "quadspeedi.net",
            "city_name": "Waltham",
            "state_name": "Massachusetts",
            "country_name": "United States",
            "country_code": "US"
        },
        "30": {
            "host_name": "watchmygirlfriend.tv",
            "ip_address": "66.254.103.140",
            "cur_status": "active",
            "alexa_rank": 13954,
            "isp_id": 714828,
            "isp_name": "Reflected Networks Inc.",
            "isp_domain": "reflected.net",
            "city_name": "Waltham",
            "state_name": "Massachusetts",
            "country_name": "United States",
            "country_code": "US"
        },
        "31": {
            "host_name": "adultforce.com",
            "ip_address": "66.254.114.168",
            "cur_status": "active",
            "alexa_rank": 14092,
            "isp_id": 714829,
            "isp_name": "Quad Speed Internet",
            "isp_domain": "quadspeedi.net",
            "city_name": "Waltham",
            "state_name": "Massachusetts",
            "country_name": "United States",
            "country_code": "US"
        },
        "32": {
            "host_name": "mydirtyhobby.de",
            "ip_address": "66.254.114.125",
            "cur_status": "active",
            "alexa_rank": 14192,
            "isp_id": 714829,
            "isp_name": "Quad Speed Internet",
            "isp_domain": "quadspeedi.net",
            "city_name": "Waltham",
            "state_name": "Massachusetts",
            "country_name": "United States",
            "country_code": "US"
        },
        "33": {
            "host_name": "trafficjunky.com",
            "ip_address": "66.254.114.181",
            "cur_status": "active",
            "alexa_rank": 15185,
            "isp_id": 714829,
            "isp_name": "Quad Speed Internet",
            "isp_domain": "quadspeedi.net",
            "city_name": "Waltham",
            "state_name": "Massachusetts",
            "country_name": "United States",
            "country_code": "US"
        },
        "34": {
            "host_name": "youporngay.com",
            "ip_address": "66.254.114.79",
            "cur_status": "active",
            "alexa_rank": 15193,
            "isp_id": 714829,
            "isp_name": "Quad Speed Internet",
            "isp_domain": "quadspeedi.net",
            "city_name": "Waltham",
            "state_name": "Massachusetts",
            "country_name": "United States",
            "country_code": "US"
        },
        "35": {
            "host_name": "pornxs.com",
            "ip_address": "66.254.114.120",
            "cur_status": "active",
            "alexa_rank": 15231,
            "isp_id": 714829,
            "isp_name": "Quad Speed Internet",
            "isp_domain": "quadspeedi.net",
            "city_name": "Waltham",
            "state_name": "Massachusetts",
            "country_name": "United States",
            "country_code": "US"
        },
        "36": {
            "host_name": "modelhub.com",
            "ip_address": "66.254.114.41",
            "cur_status": "active",
            "alexa_rank": 15416,
            "isp_id": 714829,
            "isp_name": "Quad Speed Internet",
            "isp_domain": "quadspeedi.net",
            "city_name": "Waltham",
            "state_name": "Massachusetts",
            "country_name": "United States",
            "country_code": "US"
        },
        "37": {
            "host_name": "trannytube.tv",
            "ip_address": "66.254.114.1",
            "cur_status": "active",
            "alexa_rank": 16043,
            "isp_id": 714829,
            "isp_name": "Quad Speed Internet",
            "isp_domain": "quadspeedi.net",
            "city_name": "Waltham",
            "state_name": "Massachusetts",
            "country_name": "United States",
            "country_code": "US"
        },
        "38": {
            "host_name": "xdating.com",
            "ip_address": "64.210.151.36",
            "cur_status": "active",
            "alexa_rank": 16102,
            "isp_id": 714828,
            "isp_name": "Reflected Networks Inc.",
            "isp_domain": "reflected.net",
            "city_name": "Waltham",
            "state_name": "Massachusetts",
            "country_name": "United States",
            "country_code": "US"
        },
        "39": {
            "host_name": "sportsmans.com",
            "ip_address": "157.133.232.138",
            "cur_status": "active",
            "alexa_rank": 16627,
            "isp_id": 669742,
            "isp_name": "Sybase Inc.",
            "isp_domain": "sybase.com",
            "city_name": "Waltham",
            "state_name": "Massachusetts",
            "country_name": "United States",
            "country_code": "US"
        },
        "40": {
            "host_name": "trafficjunky.net",
            "ip_address": "66.254.100.208",
            "cur_status": "active",
            "alexa_rank": 18355,
            "isp_id": 714828,
            "isp_name": "Reflected Networks Inc.",
            "isp_domain": "reflected.net",
            "city_name": "Waltham",
            "state_name": "Massachusetts",
            "country_name": "United States",
            "country_code": "US"
        },
        "41": {
            "host_name": "chatstar.com",
            "ip_address": "208.99.67.227",
            "cur_status": "active",
            "alexa_rank": 26127,
            "isp_id": 714828,
            "isp_name": "Reflected Networks Inc.",
            "isp_domain": "reflected.net",
            "city_name": "Waltham",
            "state_name": "Massachusetts",
            "country_name": "United States",
            "country_code": "US"
        },
        "42": {
            "host_name": "boy18tube.com",
            "ip_address": "216.18.168.155",
            "cur_status": "active",
            "alexa_rank": 27220,
            "isp_id": 714828,
            "isp_name": "Reflected Networks Inc.",
            "isp_domain": "reflected.net",
            "city_name": "Waltham",
            "state_name": "Massachusetts",
            "country_name": "United States",
            "country_code": "US"
        },
        "43": {
            "host_name": "mofos.com",
            "ip_address": "66.254.114.54",
            "cur_status": "active",
            "alexa_rank": 27438,
            "isp_id": 714829,
            "isp_name": "Quad Speed Internet",
            "isp_domain": "quadspeedi.net",
            "city_name": "Waltham",
            "state_name": "Massachusetts",
            "country_name": "United States",
            "country_code": "US"
        },
        "44": {
            "host_name": "rk.com",
            "ip_address": "66.254.114.54",
            "cur_status": "active",
            "alexa_rank": 30366,
            "isp_id": 714829,
            "isp_name": "Quad Speed Internet",
            "isp_domain": "quadspeedi.net",
            "city_name": "Waltham",
            "state_name": "Massachusetts",
            "country_name": "United States",
            "country_code": "US"
        },
        "45": {
            "host_name": "lpsg.com",
            "ip_address": "66.254.114.59",
            "cur_status": "active",
            "alexa_rank": 31057,
            "isp_id": 714829,
            "isp_name": "Quad Speed Internet",
            "isp_domain": "quadspeedi.net",
            "city_name": "Waltham",
            "state_name": "Massachusetts",
            "country_name": "United States",
            "country_code": "US"
        },
        "46": {
            "host_name": "julesjordan.com",
            "ip_address": "216.18.176.58",
            "cur_status": "active",
            "alexa_rank": 31426,
            "isp_id": 714828,
            "isp_name": "Reflected Networks Inc.",
            "isp_domain": "reflected.net",
            "city_name": "Waltham",
            "state_name": "Massachusetts",
            "country_name": "United States",
            "country_code": "US"
        },
        "47": {
            "host_name": "pornhubapparel.com",
            "ip_address": "216.18.168.79",
            "cur_status": "active",
            "alexa_rank": 32227,
            "isp_id": 714828,
            "isp_name": "Reflected Networks Inc.",
            "isp_domain": "reflected.net",
            "city_name": "Waltham",
            "state_name": "Massachusetts",
            "country_name": "United States",
            "country_code": "US"
        },
        "48": {
            "host_name": "sureserver.com",
            "ip_address": "192.252.159.138",
            "cur_status": "active",
            "alexa_rank": 33745,
            "isp_id": 620872,
            "isp_name": "SureSupport LLC",
            "isp_domain": "suresupport.com",
            "city_name": "Waltham",
            "state_name": "Massachusetts",
            "country_name": "United States",
            "country_code": "US"
        },
        "49": {
            "host_name": "you-porn.com",
            "ip_address": "66.254.114.79",
            "cur_status": "active",
            "alexa_rank": 33919,
            "isp_id": 714829,
            "isp_name": "Quad Speed Internet",
            "isp_domain": "quadspeedi.net",
            "city_name": "Waltham",
            "state_name": "Massachusetts",
            "country_name": "United States",
            "country_code": "US"
        },
        "50": {
            "host_name": "gayporno.fm",
            "ip_address": "216.18.168.156",
            "cur_status": "active",
            "alexa_rank": 34405,
            "isp_id": 714828,
            "isp_name": "Reflected Networks Inc.",
            "isp_domain": "reflected.net",
            "city_name": "Waltham",
            "state_name": "Massachusetts",
            "country_name": "United States",
            "country_code": "US"
        },
        "51": {
            "host_name": "lilhumpers.com",
            "ip_address": "66.254.114.54",
            "cur_status": "active",
            "alexa_rank": 35150,
            "isp_id": 714829,
            "isp_name": "Quad Speed Internet",
            "isp_domain": "quadspeedi.net",
            "city_name": "Waltham",
            "state_name": "Massachusetts",
            "country_name": "United States",
            "country_code": "US"
        },
        "52": {
            "host_name": "fakehub.com",
            "ip_address": "66.254.114.54",
            "cur_status": "active",
            "alexa_rank": 35151,
            "isp_id": 714829,
            "isp_name": "Quad Speed Internet",
            "isp_domain": "quadspeedi.net",
            "city_name": "Waltham",
            "state_name": "Massachusetts",
            "country_name": "United States",
            "country_code": "US"
        },
        "53": {
            "host_name": "pornhubselect.com",
            "ip_address": "66.254.114.42",
            "cur_status": "active",
            "alexa_rank": 35721,
            "isp_id": 714829,
            "isp_name": "Quad Speed Internet",
            "isp_domain": "quadspeedi.net",
            "city_name": "Waltham",
            "state_name": "Massachusetts",
            "country_name": "United States",
            "country_code": "US"
        },
        "54": {
            "host_name": "ice-gay.com",
            "ip_address": "66.254.114.68",
            "cur_status": "active",
            "alexa_rank": 36216,
            "isp_id": 714829,
            "isp_name": "Quad Speed Internet",
            "isp_domain": "quadspeedi.net",
            "city_name": "Waltham",
            "state_name": "Massachusetts",
            "country_name": "United States",
            "country_code": "US"
        },
        "55": {
            "host_name": "dogfartnetwork.com",
            "ip_address": "66.254.99.240",
            "cur_status": "active",
            "alexa_rank": 38429,
            "isp_id": 714828,
            "isp_name": "Reflected Networks Inc.",
            "isp_domain": "reflected.net",
            "city_name": "Waltham",
            "state_name": "Massachusetts",
            "country_name": "United States",
            "country_code": "US"
        },
        "56": {
            "host_name": "dianibeachalets.com",
            "ip_address": "192.252.151.42",
            "cur_status": "active",
            "alexa_rank": 38601,
            "isp_id": 620872,
            "isp_name": "SureSupport LLC",
            "isp_domain": "suresupport.com",
            "city_name": "Waltham",
            "state_name": "Massachusetts",
            "country_name": "United States",
            "country_code": "US"
        },
        "57": {
            "host_name": "ticketnetwork.com",
            "ip_address": "157.133.232.33",
            "cur_status": "active",
            "alexa_rank": 40142,
            "isp_id": 669742,
            "isp_name": "Sybase Inc.",
            "isp_domain": "sybase.com",
            "city_name": "Waltham",
            "state_name": "Massachusetts",
            "country_name": "United States",
            "country_code": "US"
        },
        "58": {
            "host_name": "lesbianpornvideos.com",
            "ip_address": "66.254.121.98",
            "cur_status": "active",
            "alexa_rank": 41052,
            "isp_id": 714828,
            "isp_name": "Reflected Networks Inc.",
            "isp_domain": "reflected.net",
            "city_name": "Waltham",
            "state_name": "Massachusetts",
            "country_name": "United States",
            "country_code": "US"
        },
        "59": {
            "host_name": "tube8.fr",
            "ip_address": "216.18.168.66",
            "cur_status": "active",
            "alexa_rank": 41410,
            "isp_id": 714828,
            "isp_name": "Reflected Networks Inc.",
            "isp_domain": "reflected.net",
            "city_name": "Waltham",
            "state_name": "Massachusetts",
            "country_name": "United States",
            "country_code": "US"
        },
        "60": {
            "host_name": "icegay.tv",
            "ip_address": "216.18.168.158",
            "cur_status": "active",
            "alexa_rank": 41489,
            "isp_id": 714828,
            "isp_name": "Reflected Networks Inc.",
            "isp_domain": "reflected.net",
            "city_name": "Waltham",
            "state_name": "Massachusetts",
            "country_name": "United States",
            "country_code": "US"
        },
        "61": {
            "host_name": "youpornpremium.com",
            "ip_address": "66.254.114.78",
            "cur_status": "active",
            "alexa_rank": 42236,
            "isp_id": 714829,
            "isp_name": "Quad Speed Internet",
            "isp_domain": "quadspeedi.net",
            "city_name": "Waltham",
            "state_name": "Massachusetts",
            "country_name": "United States",
            "country_code": "US"
        },
        "62": {
            "host_name": "nutaku.com",
            "ip_address": "64.210.149.50",
            "cur_status": "active",
            "alexa_rank": 43617,
            "isp_id": 714828,
            "isp_name": "Reflected Networks Inc.",
            "isp_domain": "reflected.net",
            "city_name": "Waltham",
            "state_name": "Massachusetts",
            "country_name": "United States",
            "country_code": "US"
        },
        "63": {
            "host_name": "redtube.net",
            "ip_address": "216.18.168.124",
            "cur_status": "active",
            "alexa_rank": 45504,
            "isp_id": 714828,
            "isp_name": "Reflected Networks Inc.",
            "isp_domain": "reflected.net",
            "city_name": "Waltham",
            "state_name": "Massachusetts",
            "country_name": "United States",
            "country_code": "US"
        },
        "64": {
            "host_name": "mofosex.com",
            "ip_address": "66.254.114.219",
            "cur_status": "active",
            "alexa_rank": 47129,
            "isp_id": 714829,
            "isp_name": "Quad Speed Internet",
            "isp_domain": "quadspeedi.net",
            "city_name": "Waltham",
            "state_name": "Massachusetts",
            "country_name": "United States",
            "country_code": "US"
        },
        "65": {
            "host_name": "afcpatrk.com",
            "ip_address": "216.18.168.122",
            "cur_status": "active",
            "alexa_rank": 47963,
            "isp_id": 714828,
            "isp_name": "Reflected Networks Inc.",
            "isp_domain": "reflected.net",
            "city_name": "Waltham",
            "state_name": "Massachusetts",
            "country_name": "United States",
            "country_code": "US"
        },
        "66": {
            "host_name": "cartoonpornvideos.com",
            "ip_address": "208.99.83.18",
            "cur_status": "active",
            "alexa_rank": 48897,
            "isp_id": 714828,
            "isp_name": "Reflected Networks Inc.",
            "isp_domain": "reflected.net",
            "city_name": "Waltham",
            "state_name": "Massachusetts",
            "country_name": "United States",
            "country_code": "US"
        },
        "67": {
            "host_name": "digitalplayground.com",
            "ip_address": "66.254.114.54",
            "cur_status": "active",
            "alexa_rank": 51369,
            "isp_id": 714829,
            "isp_name": "Quad Speed Internet",
            "isp_domain": "quadspeedi.net",
            "city_name": "Waltham",
            "state_name": "Massachusetts",
            "country_name": "United States",
            "country_code": "US"
        },
        "68": {
            "host_name": "tube8.es",
            "ip_address": "216.18.168.66",
            "cur_status": "active",
            "alexa_rank": 52387,
            "isp_id": 714828,
            "isp_name": "Reflected Networks Inc.",
            "isp_domain": "reflected.net",
            "city_name": "Waltham",
            "state_name": "Massachusetts",
            "country_name": "United States",
            "country_code": "US"
        },
        "69": {
            "host_name": "paperstreetcash.com",
            "ip_address": "66.254.109.5",
            "cur_status": "active",
            "alexa_rank": 53759,
            "isp_id": 714828,
            "isp_name": "Reflected Networks Inc.",
            "isp_domain": "reflected.net",
            "city_name": "Waltham",
            "state_name": "Massachusetts",
            "country_name": "United States",
            "country_code": "US"
        },
        "70": {
            "host_name": "femjoy.com",
            "ip_address": "216.18.185.244",
            "cur_status": "active",
            "alexa_rank": 53900,
            "isp_id": 714828,
            "isp_name": "Reflected Networks Inc.",
            "isp_domain": "reflected.net",
            "city_name": "Waltham",
            "state_name": "Massachusetts",
            "country_name": "United States",
            "country_code": "US"
        },
        "71": {
            "host_name": "men.com",
            "ip_address": "66.254.114.54",
            "cur_status": "active",
            "alexa_rank": 55201,
            "isp_id": 714829,
            "isp_name": "Quad Speed Internet",
            "isp_domain": "quadspeedi.net",
            "city_name": "Waltham",
            "state_name": "Massachusetts",
            "country_name": "United States",
            "country_code": "US"
        },
        "72": {
            "host_name": "brazzerssurvey.com",
            "ip_address": "216.18.168.122",
            "cur_status": "active",
            "alexa_rank": 56471,
            "isp_id": 714828,
            "isp_name": "Reflected Networks Inc.",
            "isp_domain": "reflected.net",
            "city_name": "Waltham",
            "state_name": "Massachusetts",
            "country_name": "United States",
            "country_code": "US"
        },
        "73": {
            "host_name": "playboyplus.com",
            "ip_address": "66.254.119.42",
            "cur_status": "active",
            "alexa_rank": 56511,
            "isp_id": 714828,
            "isp_name": "Reflected Networks Inc.",
            "isp_domain": "reflected.net",
            "city_name": "Waltham",
            "state_name": "Massachusetts",
            "country_name": "United States",
            "country_code": "US"
        },
        "74": {
            "host_name": "advertiserurl.com",
            "ip_address": "64.210.142.4",
            "cur_status": "active",
            "alexa_rank": 57733,
            "isp_id": 714828,
            "isp_name": "Reflected Networks Inc.",
            "isp_domain": "reflected.net",
            "city_name": "Waltham",
            "state_name": "Massachusetts",
            "country_name": "United States",
            "country_code": "US"
        },
        "75": {
            "host_name": "julesjordanvideo.com",
            "ip_address": "216.18.172.194",
            "cur_status": "active",
            "alexa_rank": 62448,
            "isp_id": 714828,
            "isp_name": "Reflected Networks Inc.",
            "isp_domain": "reflected.net",
            "city_name": "Waltham",
            "state_name": "Massachusetts",
            "country_name": "United States",
            "country_code": "US"
        },
        "76": {
            "host_name": "contentabc.com",
            "ip_address": "64.88.250.214",
            "cur_status": "active",
            "alexa_rank": 63104,
            "isp_id": 652987,
            "isp_name": "Swiftwill Inc.",
            "isp_domain": "reflected.net",
            "city_name": "Waltham",
            "state_name": "Massachusetts",
            "country_name": "United States",
            "country_code": "US"
        },
        "77": {
            "host_name": "mennetwork.com",
            "ip_address": "66.254.114.54",
            "cur_status": "active",
            "alexa_rank": 63452,
            "isp_id": 714829,
            "isp_name": "Quad Speed Internet",
            "isp_domain": "quadspeedi.net",
            "city_name": "Waltham",
            "state_name": "Massachusetts",
            "country_name": "United States",
            "country_code": "US"
        },
        "78": {
            "host_name": "melicplay.com",
            "ip_address": "66.254.111.66",
            "cur_status": "active",
            "alexa_rank": 64819,
            "isp_id": 714828,
            "isp_name": "Reflected Networks Inc.",
            "isp_domain": "reflected.net",
            "city_name": "Waltham",
            "state_name": "Massachusetts",
            "country_name": "United States",
            "country_code": "US"
        },
        "79": {
            "host_name": "babes.com",
            "ip_address": "66.254.114.54",
            "cur_status": "active",
            "alexa_rank": 65173,
            "isp_id": 714829,
            "isp_name": "Quad Speed Internet",
            "isp_domain": "quadspeedi.net",
            "city_name": "Waltham",
            "state_name": "Massachusetts",
            "country_name": "United States",
            "country_code": "US"
        },
        "80": {
            "host_name": "etnamedia.net",
            "ip_address": "66.254.100.9",
            "cur_status": "active",
            "alexa_rank": 65197,
            "isp_id": 714828,
            "isp_name": "Reflected Networks Inc.",
            "isp_domain": "reflected.net",
            "city_name": "Waltham",
            "state_name": "Massachusetts",
            "country_name": "United States",
            "country_code": "US"
        },
        "81": {
            "host_name": "good-gay.tv",
            "ip_address": "216.18.168.143",
            "cur_status": "active",
            "alexa_rank": 65432,
            "isp_id": 714828,
            "isp_name": "Reflected Networks Inc.",
            "isp_domain": "reflected.net",
            "city_name": "Waltham",
            "state_name": "Massachusetts",
            "country_name": "United States",
            "country_code": "US"
        },
        "82": {
            "host_name": "kingtwinks.com",
            "ip_address": "216.18.168.120",
            "cur_status": "active",
            "alexa_rank": 66541,
            "isp_id": 714828,
            "isp_name": "Reflected Networks Inc.",
            "isp_domain": "reflected.net",
            "city_name": "Waltham",
            "state_name": "Massachusetts",
            "country_name": "United States",
            "country_code": "US"
        },
        "83": {
            "host_name": "youngpornvideos.com",
            "ip_address": "208.99.76.166",
            "cur_status": "active",
            "alexa_rank": 67092,
            "isp_id": 714828,
            "isp_name": "Reflected Networks Inc.",
            "isp_domain": "reflected.net",
            "city_name": "Waltham",
            "state_name": "Massachusetts",
            "country_name": "United States",
            "country_code": "US"
        },
        "84": {
            "host_name": "worldsex.com",
            "ip_address": "66.254.98.132",
            "cur_status": "active",
            "alexa_rank": 67740,
            "isp_id": 714828,
            "isp_name": "Reflected Networks Inc.",
            "isp_domain": "reflected.net",
            "city_name": "Waltham",
            "state_name": "Massachusetts",
            "country_name": "United States",
            "country_code": "US"
        },
        "85": {
            "host_name": "youtrannytube.com",
            "ip_address": "66.254.114.21",
            "cur_status": "active",
            "alexa_rank": 68126,
            "isp_id": 714829,
            "isp_name": "Quad Speed Internet",
            "isp_domain": "quadspeedi.net",
            "city_name": "Waltham",
            "state_name": "Massachusetts",
            "country_name": "United States",
            "country_code": "US"
        },
        "86": {
            "host_name": "erocurves.com",
            "ip_address": "216.18.172.106",
            "cur_status": "active",
            "alexa_rank": 68357,
            "isp_id": 714828,
            "isp_name": "Reflected Networks Inc.",
            "isp_domain": "reflected.net",
            "city_name": "Waltham",
            "state_name": "Massachusetts",
            "country_name": "United States",
            "country_code": "US"
        },
        "87": {
            "host_name": "blacksonblondes.com",
            "ip_address": "66.254.99.240",
            "cur_status": "active",
            "alexa_rank": 68371,
            "isp_id": 714828,
            "isp_name": "Reflected Networks Inc.",
            "isp_domain": "reflected.net",
            "city_name": "Waltham",
            "state_name": "Massachusetts",
            "country_name": "United States",
            "country_code": "US"
        },
        "88": {
            "host_name": "xl-gaytube.com",
            "ip_address": "66.254.114.70",
            "cur_status": "active",
            "alexa_rank": 69637,
            "isp_id": 714829,
            "isp_name": "Quad Speed Internet",
            "isp_domain": "quadspeedi.net",
            "city_name": "Waltham",
            "state_name": "Massachusetts",
            "country_name": "United States",
            "country_code": "US"
        },
        "89": {
            "host_name": "redtubepremium.com",
            "ip_address": "66.254.114.78",
            "cur_status": "active",
            "alexa_rank": 70026,
            "isp_id": 714829,
            "isp_name": "Quad Speed Internet",
            "isp_domain": "quadspeedi.net",
            "city_name": "Waltham",
            "state_name": "Massachusetts",
            "country_name": "United States",
            "country_code": "US"
        },
        "90": {
            "host_name": "rong-chang.com",
            "ip_address": "192.252.146.14",
            "cur_status": "active",
            "alexa_rank": 70570,
            "isp_id": 620872,
            "isp_name": "SureSupport LLC",
            "isp_domain": "suresupport.com",
            "city_name": "Waltham",
            "state_name": "Massachusetts",
            "country_name": "United States",
            "country_code": "US"
        },
        "91": {
            "host_name": "martinsatacado.com.br",
            "ip_address": "157.133.232.57",
            "cur_status": "active",
            "alexa_rank": 70921,
            "isp_id": 669742,
            "isp_name": "Sybase Inc.",
            "isp_domain": "sybase.com",
            "city_name": "Waltham",
            "state_name": "Massachusetts",
            "country_name": "United States",
            "country_code": "US"
        },
        "92": {
            "host_name": "hugetraffic.com",
            "ip_address": "64.210.151.40",
            "cur_status": "active",
            "alexa_rank": 70952,
            "isp_id": 714828,
            "isp_name": "Reflected Networks Inc.",
            "isp_domain": "reflected.net",
            "city_name": "Waltham",
            "state_name": "Massachusetts",
            "country_name": "United States",
            "country_code": "US"
        },
        "93": {
            "host_name": "good-gay.com",
            "ip_address": "66.254.114.71",
            "cur_status": "active",
            "alexa_rank": 73546,
            "isp_id": 714829,
            "isp_name": "Quad Speed Internet",
            "isp_domain": "quadspeedi.net",
            "city_name": "Waltham",
            "state_name": "Massachusetts",
            "country_name": "United States",
            "country_code": "US"
        },
        "94": {
            "host_name": "gaytube.com",
            "ip_address": "66.254.114.158",
            "cur_status": "active",
            "alexa_rank": 79567,
            "isp_id": 714829,
            "isp_name": "Quad Speed Internet",
            "isp_domain": "quadspeedi.net",
            "city_name": "Waltham",
            "state_name": "Massachusetts",
            "country_name": "United States",
            "country_code": "US"
        },
        "95": {
            "host_name": "gfpornmovies.com",
            "ip_address": "66.254.103.145",
            "cur_status": "active",
            "alexa_rank": 79926,
            "isp_id": 714828,
            "isp_name": "Reflected Networks Inc.",
            "isp_domain": "reflected.net",
            "city_name": "Waltham",
            "state_name": "Massachusetts",
            "country_name": "United States",
            "country_code": "US"
        },
        "96": {
            "host_name": "gayfuckporn.com",
            "ip_address": "66.254.114.67",
            "cur_status": "active",
            "alexa_rank": 80321,
            "isp_id": 714829,
            "isp_name": "Quad Speed Internet",
            "isp_domain": "quadspeedi.net",
            "city_name": "Waltham",
            "state_name": "Massachusetts",
            "country_name": "United States",
            "country_code": "US"
        },
        "97": {
            "host_name": "sexyhub.com",
            "ip_address": "66.254.114.54",
            "cur_status": "active",
            "alexa_rank": 81010,
            "isp_id": 714829,
            "isp_name": "Quad Speed Internet",
            "isp_domain": "quadspeedi.net",
            "city_name": "Waltham",
            "state_name": "Massachusetts",
            "country_name": "United States",
            "country_code": "US"
        },
        "98": {
            "host_name": "newsensations.com",
            "ip_address": "66.254.114.75",
            "cur_status": "active",
            "alexa_rank": 81498,
            "isp_id": 714829,
            "isp_name": "Quad Speed Internet",
            "isp_domain": "quadspeedi.net",
            "city_name": "Waltham",
            "state_name": "Massachusetts",
            "country_name": "United States",
            "country_code": "US"
        },
        "99": {
            "host_name": "liltmedia.com",
            "ip_address": "66.254.111.91",
            "cur_status": "active",
            "alexa_rank": 81540,
            "isp_id": 714828,
            "isp_name": "Reflected Networks Inc.",
            "isp_domain": "reflected.net",
            "city_name": "Waltham",
            "state_name": "Massachusetts",
            "country_name": "United States",
            "country_code": "US"
        },
        "100": {
            "host_name": "buddyplay.net",
            "ip_address": "66.254.111.108",
            "cur_status": "active",
            "alexa_rank": 83072,
            "isp_id": 714828,
            "isp_name": "Reflected Networks Inc.",
            "isp_domain": "reflected.net",
            "city_name": "Waltham",
            "state_name": "Massachusetts",
            "country_name": "United States",
            "country_code": "US"
        }
    },
    "stats": {
        "total_results": 68387,
        "total_pages": 684,
        "current_page_num": 1,
        "current_page_results": 100,
        "next_page_num": 2,
        "next_page_results": 100,
        "your_ip_address": "3.236.11.52",
        "query_time": "2020-07-02 18:43:37",
        "execution_time": 0.17,
        "api_credits_used": 1
    }
}
Download Results in CSV Format Price Order
First 100 Results (free sample) FREE Download
All Results (full data set containing all 68,387 results) $25 Purchase
Daily Feeds (download the latest data once every day for a month) $125/month Subscribe
Weekly Feeds (download the latest data once every week for 3 months) $125/quarter Subscribe
Monthly Feeds (download the latest data once every month for a year) $125/year Subscribe